PAH Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PAH Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25237
• Hersteller Artikelnummer: A25237
• Alternativnummer: ABB-A25237-100UL,ABB-A25237-20UL,ABB-A25237-500UL,ABB-A25237-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PH, PKU, PKU1, PAH

Produktbeschreibung

This gene encodes a member of the biopterin-dependent aromatic amino acid hydroxylase protein family. The encoded phenylalanine hydroxylase enzyme hydroxylates phenylalanine to tyrosine and is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 52kDa
• NCBI: 5053
• UniProt: P00439
• Reinheit: Affinity purification
• Sequenz: SRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKL
• Target-Kategorie: PAH
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat liver usingPAH Rabbit pAb (A25237) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.