PAH Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PAH Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25237
• Supplier Catalog Number: A25237
• Alternative Catalog Number: ABB-A25237-100UL,ABB-A25237-20UL,ABB-A25237-500UL,ABB-A25237-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PH, PKU, PKU1, PAH

Product Description

This gene encodes a member of the biopterin-dependent aromatic amino acid hydroxylase protein family. The encoded phenylalanine hydroxylase enzyme hydroxylates phenylalanine to tyrosine and is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 52kDa
• NCBI: 5053
• UniProt: P00439
• Purity: Affinity purification
• Sequence: SRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKL
• Target: PAH
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat liver usingPAH Rabbit pAb (A25237) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.