SPDEF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25238
Artikelname: SPDEF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25238
Hersteller Artikelnummer: A25238
Alternativnummer: ABB-A25238-100UL,ABB-A25238-20UL,ABB-A25238-1000UL,ABB-A25238-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PDEF, bA375E1.3, SPDEF
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 25803
UniProt: O95238
Reinheit: Affinity purification
Sequenz: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQA
Target-Kategorie: SPDEF
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates usingSPDEF Rabbit pAb (A25238) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):K-562.
Exposure time:30s.