SPDEF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A25238
Article Name: SPDEF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A25238
Supplier Catalog Number: A25238
Alternative Catalog Number: ABB-A25238-100UL,ABB-A25238-20UL,ABB-A25238-1000UL,ABB-A25238-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PDEF, bA375E1.3, SPDEF
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 25803
UniProt: O95238
Purity: Affinity purification
Sequence: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQA
Target: SPDEF
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates usingSPDEF Rabbit pAb (A25238) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):K-562.
Exposure time:30s.