NKX2-2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NKX2-2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25248
• Hersteller Artikelnummer: A25248
• Alternativnummer: ABB-A25248-20UL,ABB-A25248-100UL,ABB-A25248-1000UL,ABB-A25248-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NKX2B, NKX2.2, NKX2-2

Produktbeschreibung

The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 30kDa
• NCBI: 4821
• UniProt: O95096
• Reinheit: Affinity purification
• Sequenz: KSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPR
• Target-Kategorie: NKX2-2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Neuroscience,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and293T cells transfected withNKX2-2 usingNKX2-2 Rabbit pAb (A25248) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.