NKX2-2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NKX2-2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25248
• Supplier Catalog Number: A25248
• Alternative Catalog Number: ABB-A25248-20UL,ABB-A25248-100UL,ABB-A25248-1000UL,ABB-A25248-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NKX2B, NKX2.2, NKX2-2

Product Description

The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 30kDa
• NCBI: 4821
• UniProt: O95096
• Purity: Affinity purification
• Sequence: KSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPR
• Target: NKX2-2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Neuroscience,Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293T cells transfected withNKX2-2 usingNKX2-2 Rabbit pAb (A25248) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.