CD168/RHAMM Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD168/RHAMM Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2540
• Hersteller Artikelnummer: A2540
• Alternativnummer: ABB-A2540-100UL,ABB-A2540-20UL,ABB-A2540-1000UL,ABB-A2540-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CD168, IHABP, RHAMM, CD168/RHAMM

Produktbeschreibung

The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 84kDa
• NCBI: 3161
• UniProt: O75330
• Reinheit: Affinity purification
• Sequenz: LQIDSLLQQEKELSSSLHQKLCSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKLKGKEAELEKSSAAHTQATL
• Target-Kategorie: HMMR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Cell Biology Developmental Biology,Immunology Inflammation,CDs,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CD168/RHAMM Rabbit pAb (A2540) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.