CD168/RHAMM Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD168/RHAMM Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2540
• Supplier Catalog Number: A2540
• Alternative Catalog Number: ABB-A2540-100UL,ABB-A2540-20UL,ABB-A2540-1000UL,ABB-A2540-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CD168, IHABP, RHAMM, CD168/RHAMM

Product Description

The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 84kDa
• NCBI: 3161
• UniProt: O75330
• Purity: Affinity purification
• Sequence: LQIDSLLQQEKELSSSLHQKLCSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKLKGKEAELEKSSAAHTQATL
• Target: HMMR
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Cell Biology Developmental Biology,Immunology Inflammation,CDs,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CD168/RHAMM Rabbit pAb (A2540) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.