Estrogen Receptor beta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2546
- Bilder (1)
| Artikelname: | Estrogen Receptor beta Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2546 |
| Hersteller Artikelnummer: | A2546 |
| Alternativnummer: | ABB-A2546-100UL,ABB-A2546-20UL,ABB-A2546-500UL,ABB-A2546-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Erb, ESRB, ODG8, ESTRB, NR3A2, ER-BETA, ESR-BETA, Estrogen Receptor beta |
| This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 59kDa |
| NCBI: | 2100 |
| UniProt: | Q92731 |
| Reinheit: | Affinity purification |
| Sequenz: | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCS |
| Target-Kategorie: | ESR2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Cancer,Tumor biomarkers,Signal Transduction,MAPK-Erk Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Neuroscience. Shipping: Ice Bag |

