Orexin B/Hypocretin-2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Orexin B/Hypocretin-2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25596
• Hersteller Artikelnummer: A25596
• Alternativnummer: ABB-A25596-500UL,ABB-A25596-20UL,ABB-A25596-1000UL,ABB-A25596-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: OX, PPOX, NRCLP1

Produktbeschreibung

This gene encodes a hypothalamic neuropeptide precursor protein that gives rise to two mature neuropeptides, orexin A and orexin B, by proteolytic processing. Orexin A and orexin B, which bind to orphan G-protein coupled receptors HCRTR1 and HCRTR2, function in the regulation of sleep and arousal. This neuropeptide arrangement may also play a role in feeding behavior, metabolism, and homeostasis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 13kDa
• NCBI: 3060
• UniProt: O43612
• Reinheit: Affinity purification
• Sequenz: MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRR
• Target-Kategorie: HCRT

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and293F cells transfected withOrexin B/Hypocretin-2 usingOrexin B/Hypocretin-2 Rabbit pAb (A25596) at1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.