Orexin B/Hypocretin-2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Orexin B/Hypocretin-2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25596
• Supplier Catalog Number: A25596
• Alternative Catalog Number: ABB-A25596-500UL,ABB-A25596-20UL,ABB-A25596-1000UL,ABB-A25596-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: OX, PPOX, NRCLP1

Product Description

This gene encodes a hypothalamic neuropeptide precursor protein that gives rise to two mature neuropeptides, orexin A and orexin B, by proteolytic processing. Orexin A and orexin B, which bind to orphan G-protein coupled receptors HCRTR1 and HCRTR2, function in the regulation of sleep and arousal. This neuropeptide arrangement may also play a role in feeding behavior, metabolism, and homeostasis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 13kDa
• NCBI: 3060
• UniProt: O43612
• Purity: Affinity purification
• Sequence: MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRR
• Target: HCRT

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293F cells transfected withOrexin B/Hypocretin-2 usingOrexin B/Hypocretin-2 Rabbit pAb (A25596) at1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.