PLIN5 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PLIN5 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25598
• Hersteller Artikelnummer: A25598
• Alternativnummer: ABB-A25598-100UL,ABB-A25598-1000UL,ABB-A25598-20UL,ABB-A25598-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MLDP, LSDA5, LSDP5, OXPAT

Produktbeschreibung

Predicted to enable identical protein binding activity and lipase binding activity. Predicted to be involved in several processes, including negative regulation of peroxisome proliferator activated receptor signaling pathway, regulation of lipase activity, and regulation of lipid metabolic process. Located in intracellular membrane-bounded organelle and lipid droplet.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 51kDa
• NCBI: 440503
• UniProt: Q00G26
• Reinheit: Affinity purification
• Sequenz: ESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIG
• Target-Kategorie: PLIN5

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse heart usingPLIN5 Rabbit pAb (A25598) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.