PLIN5 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PLIN5 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25598
• Supplier Catalog Number: A25598
• Alternative Catalog Number: ABB-A25598-100UL,ABB-A25598-1000UL,ABB-A25598-20UL,ABB-A25598-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MLDP, LSDA5, LSDP5, OXPAT

Product Description

Predicted to enable identical protein binding activity and lipase binding activity. Predicted to be involved in several processes, including negative regulation of peroxisome proliferator activated receptor signaling pathway, regulation of lipase activity, and regulation of lipid metabolic process. Located in intracellular membrane-bounded organelle and lipid droplet.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 440503
• UniProt: Q00G26
• Purity: Affinity purification
• Sequence: ESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIG
• Target: PLIN5

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse heart usingPLIN5 Rabbit pAb (A25598) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.