CCR7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CCR7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25849
• Hersteller Artikelnummer: A25849
• Alternativnummer: ABB-A25849-20UL,ABB-A25849-1000UL,ABB-A25849-100UL,ABB-A25849-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EBI1, CCR-7, CD197, Ebi1h, Cdw197, Cmkbr7, CC-CKR-7

Produktbeschreibung

Enables C-C chemokine receptor activity. Involved in several processes, including positive regulation of immune response, positive regulation of leukocyte chemotaxis, and regulation of cytokine production. Acts upstream of or within chemotaxis, homeostasis of number of cells, and immune response. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system, central nervous system, immune system, reproductive system, and white fat. Used to study Sjogrens syndrome. Orthologous to human CCR7 (C-C motif chemokine receptor 7).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 43kDa
• NCBI: 12775
• UniProt: P47774
• Reinheit: Affinity purification
• Sequenz: SLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDV
• Target-Kategorie: Ccr7

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Immunology Innate Immunity Chemokines Beta Chemokine Rec. (CCR)Signal Transduction Signaling Pathway G Protein Signaling GPCRMicrobiology Organism Virus RNA Virus ssRNA positive strand virus SARS Coronavirus. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat spleen using CCR7 Rabbit pAb (A25849) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.