CCR7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CCR7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25849
• Supplier Catalog Number: A25849
• Alternative Catalog Number: ABB-A25849-20UL,ABB-A25849-1000UL,ABB-A25849-100UL,ABB-A25849-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EBI1, CCR-7, CD197, Ebi1h, Cdw197, Cmkbr7, CC-CKR-7

Product Description

Enables C-C chemokine receptor activity. Involved in several processes, including positive regulation of immune response, positive regulation of leukocyte chemotaxis, and regulation of cytokine production. Acts upstream of or within chemotaxis, homeostasis of number of cells, and immune response. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system, central nervous system, immune system, reproductive system, and white fat. Used to study Sjogrens syndrome. Orthologous to human CCR7 (C-C motif chemokine receptor 7).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 43kDa
• NCBI: 12775
• UniProt: P47774
• Purity: Affinity purification
• Sequence: SLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDV
• Target: Ccr7

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Immunology Innate Immunity Chemokines Beta Chemokine Rec. (CCR)Signal Transduction Signaling Pathway G Protein Signaling GPCRMicrobiology Organism Virus RNA Virus ssRNA positive strand virus SARS Coronavirus. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat spleen using CCR7 Rabbit pAb (A25849) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.