NT5E/CD73 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: NT5E/CD73 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A25914
• Hersteller Artikelnummer: A25914
• Alternativnummer: ABB-A25914-1000UL,ABB-A25914-500UL,ABB-A25914-100UL,ABB-A25914-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NT, eN, NT5, NTE, eNT, CD73, E5NT, CALJA

Produktbeschreibung

The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Molekulargewicht: 57kDa/63kDa
• NCBI: 4907
• UniProt: P21589
• Reinheit: Affinity purification
• Sequenz: WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAY
• Target-Kategorie: NT5E

Anwendungsbeschreibung

• Application Verdünnung: WB,1:80000 - 1:160000|IF-P,1:50 - 1:200|IHC-P,1:300 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,CDs,Stem Cells,Cardiovascular,Hypoxia.

Bilder

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of various lysates using NT5E/CD73 Rabbit mAb (A25914) at 1:160000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Raji, RAW 264.7
Exposure time: 45 s.

Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Confocal imaging of paraffin-embedded Mouse brain tissue using NT5E/CD73 Rabbit mAb (A25914, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.