NT5E/CD73 Rabbit mAb, Unconjugated

Product Overview

• Article Name: NT5E/CD73 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A25914
• Supplier Catalog Number: A25914
• Alternative Catalog Number: ABB-A25914-1000UL,ABB-A25914-500UL,ABB-A25914-100UL,ABB-A25914-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NT, eN, NT5, NTE, eNT, CD73, E5NT, CALJA

Product Description

The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Molecular Weight: 57kDa/63kDa
• NCBI: 4907
• UniProt: P21589
• Purity: Affinity purification
• Sequence: WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAY
• Target: NT5E

Application Notes

• Application Dilute: WB,1:80000 - 1:160000|IF-P,1:50 - 1:200|IHC-P,1:300 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,CDs,Stem Cells,Cardiovascular,Hypoxia.

Images

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of various lysates using NT5E/CD73 Rabbit mAb (A25914) at 1:160000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Raji, RAW 264.7
Exposure time: 45 s.

Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using NT5E/CD73 Rabbit mAb (A25914) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Confocal imaging of paraffin-embedded Mouse brain tissue using NT5E/CD73 Rabbit mAb (A25914, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.