ZNF683 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ZNF683 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A26154
• Hersteller Artikelnummer: A26154
• Alternativnummer: ABB-A26154-20UL,ABB-A26154-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Hobit,ZNF683

Produktbeschreibung

Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in T cell receptor signaling pathway, cellular response to ionomycin, and regulation of gene expression. Predicted to be located in nucleus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 57kDa
• NCBI: 257101
• UniProt: Q8IZ20
• Reinheit: Affinity purification
• Sequenz: HSGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYDIDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN
• Target-Kategorie: ZNF683

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics and Nuclear Signaling Transcription Domain Families Zinc FingerEpigenetics and Nuclear Signaling DNA / RNA RNA Processing OtherEpigenetics and Nuclear Signaling Chromatin Binding Proteins DNA / RNA binding. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with ZNF683 using ZNF683 Rabbit pAb (A26154) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 10s.