ZNF683 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ZNF683 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A26154
• Supplier Catalog Number: A26154
• Alternative Catalog Number: ABB-A26154-20UL,ABB-A26154-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Hobit,ZNF683

Product Description

Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in T cell receptor signaling pathway, cellular response to ionomycin, and regulation of gene expression. Predicted to be located in nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 57kDa
• NCBI: 257101
• UniProt: Q8IZ20
• Purity: Affinity purification
• Sequence: HSGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYDIDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN
• Target: ZNF683

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics and Nuclear Signaling Transcription Domain Families Zinc FingerEpigenetics and Nuclear Signaling DNA / RNA RNA Processing OtherEpigenetics and Nuclear Signaling Chromatin Binding Proteins DNA / RNA binding. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with ZNF683 using ZNF683 Rabbit pAb (A26154) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 10s.