FOXP3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FOXP3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A27170
• Hersteller Artikelnummer: A27170
• Alternativnummer: ABB-A27170-500UL,ABB-A27170-1000UL,ABB-A27170-100UL,ABB-A27170-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: sf, JM2, scurfin

Produktbeschreibung

The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene result in the scurfy phenotype (sf). Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 20371
• UniProt: Q99JB6
• Reinheit: Affinity purification
• Sequenz: MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH
• Target-Kategorie: Foxp3

Anwendungsbeschreibung

• Application Verdünnung: WB,1:3000 - 1:18000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cell Biology Cell Cycle Cell Division Chromatid CohesionEpigenetics and Nuclear Signaling Transcription Domain Families Forkhead Box FOXPImmunology Adaptive Immunity Regulatory T Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with FOXP3 using FOXP3 Rabbit pAb (A27170) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 0.5s.