FOXP3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: FOXP3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A27170
• Supplier Catalog Number: A27170
• Alternative Catalog Number: ABB-A27170-500UL,ABB-A27170-1000UL,ABB-A27170-100UL,ABB-A27170-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: sf, JM2, scurfin

Product Description

The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene result in the scurfy phenotype (sf). Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 20371
• UniProt: Q99JB6
• Purity: Affinity purification
• Sequence: MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH
• Target: Foxp3

Application Notes

• Application Dilute: WB,1:3000 - 1:18000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cell Biology Cell Cycle Cell Division Chromatid CohesionEpigenetics and Nuclear Signaling Transcription Domain Families Forkhead Box FOXPImmunology Adaptive Immunity Regulatory T Cells. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with FOXP3 using FOXP3 Rabbit pAb (A27170) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 0.5s.