CFHR1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CFHR1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2743
• Hersteller Artikelnummer: A2743
• Alternativnummer: ABB-A2743-100UL,ABB-A2743-20UL,ABB-A2743-1000UL,ABB-A2743-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: H36, CFHL, FHR1, HFL1, HFL2, CFHL1, FHL-1, FHR-1, H36-1, H36-2, CFHL1P, CFHR1P, CFHR1

Produktbeschreibung

This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 38kDa
• NCBI: 3078
• UniProt: Q03591
• Reinheit: Affinity purification
• Sequenz: PTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
• Target-Kategorie: CFHR1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CFHR1 Rabbit pAb (A2743) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.