CFHR1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CFHR1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2743
• Supplier Catalog Number: A2743
• Alternative Catalog Number: ABB-A2743-100UL,ABB-A2743-20UL,ABB-A2743-1000UL,ABB-A2743-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: H36, CFHL, FHR1, HFL1, HFL2, CFHL1, FHL-1, FHR-1, H36-1, H36-2, CFHL1P, CFHR1P, CFHR1

Product Description

This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 3078
• UniProt: Q03591
• Purity: Affinity purification
• Sequence: PTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
• Target: CFHR1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CFHR1 Rabbit pAb (A2743) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.