APC Rabbit anti-Mouse TNF-alpha mAb, Monoclonal

Artikelnummer: ABB-A27728
Artikelname: APC Rabbit anti-Mouse TNF-alpha mAb, Monoclonal
Artikelnummer: ABB-A27728
Hersteller Artikelnummer: A27728
Alternativnummer: ABB-A27728-100UG,ABB-A27728-25UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: APC
Alternative Synonym: DIF, Tnfa, TNF-a, TNFSF2, Tnlg1f, Tnfsf1a, TNFalpha, TNF-alpha
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Konzentration: FC (intra)
Molekulargewicht: 26kDa
NCBI: 21926
UniProt: P06804
Reinheit: Affinity purification
Sequenz: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Target-Kategorie: Tnf
Application Verdünnung: FC (intra),0.5 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Growth factors,Death Receptor Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Immunology Inflammation,Cytokines,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Cardiovascular. Shipping: Ice Bag
Flowcytometry:1X10 6C57BL/6mousesplenocytes (untreated,left)andC57BL/6mousesplenocytes(treatedwithPMA+Ionomycininthepresenceofmonensin,right)weresurface-stainedwithPEanti-MouseCD3emAb (A26897,5ul/test), andthenintracellularly-stainedwithAPCRabbitanti-MouseTNF-alphamAb(A27728,0.5ug).