APC Rabbit anti-Mouse TNF-alpha mAb, Monoclonal

Catalog Number: ABB-A27728
Article Name: APC Rabbit anti-Mouse TNF-alpha mAb, Monoclonal
Biozol Catalog Number: ABB-A27728
Supplier Catalog Number: A27728
Alternative Catalog Number: ABB-A27728-100UG,ABB-A27728-25UG
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: APC
Alternative Names: DIF, Tnfa, TNF-a, TNFSF2, Tnlg1f, Tnfsf1a, TNFalpha, TNF-alpha
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants.
Clonality: Monoclonal
Concentration: FC (intra)
Molecular Weight: 26kDa
NCBI: 21926
UniProt: P06804
Purity: Affinity purification
Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Target: Tnf
Application Dilute: FC (intra),0.5 µg per million cells in 100 µl volume
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Growth factors,Death Receptor Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Immunology Inflammation,Cytokines,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Cardiovascular. Shipping: Ice Bag
Flowcytometry:1X10 6C57BL/6mousesplenocytes (untreated,left)andC57BL/6mousesplenocytes(treatedwithPMA+Ionomycininthepresenceofmonensin,right)weresurface-stainedwithPEanti-MouseCD3emAb (A26897,5ul/test), andthenintracellularly-stainedwithAPCRabbitanti-MouseTNF-alphamAb(A27728,0.5ug).