MTNR1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A27759
Artikelname: MTNR1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A27759
Hersteller Artikelnummer: A27759
Alternativnummer: ABB-A27759-20UL,ABB-A27759-500UL,ABB-A27759-1000UL,ABB-A27759-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MT1, MEL-1A-R
This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin.
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 4543
UniProt: P48039
Reinheit: Affinity purification
Sequenz: VASDPASMVPRIPEWLFVASYYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Target-Kategorie: MTNR1A
Application Verdünnung: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using MTNR1A Rabbit pAb (A27759) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.