MTNR1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A27759
Article Name: MTNR1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A27759
Supplier Catalog Number: A27759
Alternative Catalog Number: ABB-A27759-20UL,ABB-A27759-500UL,ABB-A27759-1000UL,ABB-A27759-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MT1, MEL-1A-R
This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin.
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 4543
UniProt: P48039
Purity: Affinity purification
Sequence: VASDPASMVPRIPEWLFVASYYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Target: MTNR1A
Application Dilute: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using MTNR1A Rabbit pAb (A27759) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.