CD33 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD33 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A27767
• Hersteller Artikelnummer: A27767
• Alternativnummer: ABB-A27767-1000UL,ABB-A27767-20UL,ABB-A27767-100UL,ABB-A27767-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: p67, SIGLEC3, SIGLEC-3

Produktbeschreibung

Enables protein phosphatase binding activity and sialic acid binding activity. Involved in several processes, including negative regulation of cytokine production, negative regulation of monocyte activation, and positive regulation of protein tyrosine phosphatase activity. Located in several cellular components, including Golgi apparatus, external side of plasma membrane, and peroxisome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 40kDa
• NCBI: 945
• UniProt: P20138
• Reinheit: Affinity purification
• Sequenz: AGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
• Target-Kategorie: CD33

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from THP-1 cells using CD33 Rabbit pAb (A27767) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.