CD33 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD33 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A27767
• Supplier Catalog Number: A27767
• Alternative Catalog Number: ABB-A27767-1000UL,ABB-A27767-20UL,ABB-A27767-100UL,ABB-A27767-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: p67, SIGLEC3, SIGLEC-3

Product Description

Enables protein phosphatase binding activity and sialic acid binding activity. Involved in several processes, including negative regulation of cytokine production, negative regulation of monocyte activation, and positive regulation of protein tyrosine phosphatase activity. Located in several cellular components, including Golgi apparatus, external side of plasma membrane, and peroxisome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 40kDa
• NCBI: 945
• UniProt: P20138
• Purity: Affinity purification
• Sequence: AGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
• Target: CD33

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Western blot analysis of lysates from THP-1 cells using CD33 Rabbit pAb (A27767) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.