CLEC4E Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CLEC4E Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A28097
• Hersteller Artikelnummer: A28097
• Alternativnummer: ABB-A28097-20UL,ABB-A28097-1000UL,ABB-A28097-500UL,ABB-A28097-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Mincle, Clecsf9

Produktbeschreibung

Enables glycolipid binding activity and pattern recognition receptor activity. Involved in antifungal innate immune response and positive regulation of cytokine production. Acts upstream of or within Fc-gamma receptor signaling pathway, T cell differentiation involved in immune response, and defense response to bacterium. Is active in phagocytic vesicle membrane and plasma membrane. Orthologous to human CLEC4E (C-type lectin domain family 4 member E).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 24kDa
• NCBI: 56619
• UniProt: Q9R0Q8
• Reinheit: Affinity purification
• Sequenz: TQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYS
• Target-Kategorie: Clec4e

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat liver using CLEC4E Rabbit pAb (A28097) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.