CLEC4E Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CLEC4E Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A28097
• Supplier Catalog Number: A28097
• Alternative Catalog Number: ABB-A28097-20UL,ABB-A28097-1000UL,ABB-A28097-500UL,ABB-A28097-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Mincle, Clecsf9

Product Description

Enables glycolipid binding activity and pattern recognition receptor activity. Involved in antifungal innate immune response and positive regulation of cytokine production. Acts upstream of or within Fc-gamma receptor signaling pathway, T cell differentiation involved in immune response, and defense response to bacterium. Is active in phagocytic vesicle membrane and plasma membrane. Orthologous to human CLEC4E (C-type lectin domain family 4 member E).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 56619
• UniProt: Q9R0Q8
• Purity: Affinity purification
• Sequence: TQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYS
• Target: Clec4e

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat liver using CLEC4E Rabbit pAb (A28097) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.