PE Rabbit anti-Mouse CD84 mAb, Monoclonal

Produktübersicht

• Artikelname: PE Rabbit anti-Mouse CD84 mAb, Monoclonal
• Artikelnummer: ABB-A28102
• Hersteller Artikelnummer: A28102
• Alternativnummer: ABB-A28102-25UG,ABB-A28102-100UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: PE
• Alternative Synonym: CDw84, SLAMF5, A130013D22Rik

Produktbeschreibung

Predicted to enable identical protein binding activity. Involved in regulation of gene expression, regulation of macrophage activation, and regulation of signal transduction. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Is expressed in brain, embryo, and testis. Orthologous to human CD84 (CD84 molecule).

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 37kDa
• NCBI: 12523
• UniProt: Q18PI6
• Reinheit: Affinity purification
• Sequenz: KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV
• Target-Kategorie: Cd84

Anwendungsbeschreibung

• Application Verdünnung: FC, 0.5 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology & Inflammation,CD markers,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Bilder

Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit anti-Mouse CD84 mAb (A28102,0.5 µg,orange line) or PE Rabbit IgG isotype control (A24172,5 µl/Test,blue line). Non-fluorescently stained cells were used as blank control (red line).