PE Rabbit anti-Mouse CD84 mAb, Monoclonal

Catalog Number: ABB-A28102
Article Name: PE Rabbit anti-Mouse CD84 mAb, Monoclonal
Biozol Catalog Number: ABB-A28102
Supplier Catalog Number: A28102
Alternative Catalog Number: ABB-A28102-25UG,ABB-A28102-100UG
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: PE
Alternative Names: CDw84, SLAMF5, A130013D22Rik
Predicted to enable identical protein binding activity. Involved in regulation of gene expression, regulation of macrophage activation, and regulation of signal transduction. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Is expressed in brain, embryo, and testis. Orthologous to human CD84 (CD84 molecule).
Clonality: Monoclonal
Concentration: FC
Molecular Weight: 37kDa
NCBI: 12523
UniProt: Q18PI6
Purity: Affinity purification
Sequence: KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV
Target: Cd84
Application Dilute: FC, 0.5 µg per million cells in 100 µl volume
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology & Inflammation,CD markers,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag
Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit anti-Mouse CD84 mAb (A28102,0.5 µg,orange line) or PE Rabbit IgG isotype control (A24172,5 µl/Test,blue line). Non-fluorescently stained cells were used as blank control (red line).