RAB18 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2812
- Bilder (1)
| Artikelname: | RAB18 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2812 |
| Hersteller Artikelnummer: | A2812 |
| Alternativnummer: | ABB-A2812-500UL,ABB-A2812-1000UL,ABB-A2812-100UL,ABB-A2812-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | WARBM3, RAB18LI1, RAB18 |
| The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 23kDa |
| NCBI: | 22931 |
| UniProt: | Q9NP72 |
| Reinheit: | Affinity purification |
| Sequenz: | MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL |
| Target-Kategorie: | RAB18 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag |

