RAB18 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RAB18 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2812
• Supplier Catalog Number: A2812
• Alternative Catalog Number: ABB-A2812-500UL,ABB-A2812-1000UL,ABB-A2812-100UL,ABB-A2812-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: WARBM3, RAB18LI1, RAB18

Product Description

The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 23kDa
• NCBI: 22931
• UniProt: Q9NP72
• Purity: Affinity purification
• Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL
• Target: RAB18
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag

Images

Western blot analysis of various lysates using RAB18 Rabbit pAb (A2812) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.