PE/Cyanine7 Rabbit anti-Mouse CD19 mAb, PE/Cy7, Monoclonal

Produktübersicht

• Artikelname: PE/Cyanine7 Rabbit anti-Mouse CD19 mAb, PE/Cy7, Monoclonal
• Artikelnummer: ABB-A28124
• Hersteller Artikelnummer: A28124
• Alternativnummer: ABB-A28124-100UG,ABB-A28124-25UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: PE/Cy7

Produktbeschreibung

Involved in several processes, including B-1 B cell differentiation, positive regulation of phosphatidylinositol 3-kinase activity, and positive regulation of release of sequestered calcium ion into cytosol. Acts upstream of or within B cell receptor signaling pathway. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in liver and spleen. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD19 (CD19 molecule).

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 60kDa
• NCBI: 12478
• UniProt: P25918
• Reinheit: Affinity purification
• Sequenz: RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVI
• Target-Kategorie: Cd19

Anwendungsbeschreibung

• Application Verdünnung: FC, 0.25 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Adaptive Immunity B Cells CD. Shipping: Ice Bag

Bilder

Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes were surface-stained with ABflo 488 Rabbit anti-Human/Monkey CD3 mAb (A26283,5 µl/Test) and PE/Cyanine7 Rabbit IgG isotype control (5 µl/Test,left) or PE/Cyanine7 Rabbit anti-Mouse CD19 mAb (A28124,0.25 µg,right).