PE/Cyanine7 Rabbit anti-Mouse CD19 mAb, PE/Cy7, Monoclonal

Product Overview

• Article Name: PE/Cyanine7 Rabbit anti-Mouse CD19 mAb, PE/Cy7, Monoclonal
• Biozol Catalog Number: ABB-A28124
• Supplier Catalog Number: A28124
• Alternative Catalog Number: ABB-A28124-100UG,ABB-A28124-25UG
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: FC
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: PE/Cy7

Product Description

Involved in several processes, including B-1 B cell differentiation, positive regulation of phosphatidylinositol 3-kinase activity, and positive regulation of release of sequestered calcium ion into cytosol. Acts upstream of or within B cell receptor signaling pathway. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in liver and spleen. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD19 (CD19 molecule).

Product Properties

• Clonality: Monoclonal
• Concentration: FC
• Molecular Weight: 60kDa
• NCBI: 12478
• UniProt: P25918
• Purity: Affinity purification
• Sequence: RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVI
• Target: Cd19

Application Notes

• Application Dilute: FC, 0.25 µg per million cells in 100 µl volume
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Adaptive Immunity B Cells CD. Shipping: Ice Bag

Images

Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes were surface-stained with ABflo 488 Rabbit anti-Human/Monkey CD3 mAb (A26283,5 µl/Test) and PE/Cyanine7 Rabbit IgG isotype control (5 µl/Test,left) or PE/Cyanine7 Rabbit anti-Mouse CD19 mAb (A28124,0.25 µg,right).