PE Rabbit anti-Mouse CD122/IL-2Rbeta mAb, Monoclonal

Produktübersicht

• Artikelname: PE Rabbit anti-Mouse CD122/IL-2Rbeta mAb, Monoclonal
• Artikelnummer: ABB-A28145
• Hersteller Artikelnummer: A28145
• Alternativnummer: ABB-A28145-25UG,ABB-A28145-100UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: PE
• Alternative Synonym: p70, CD122, IL15Rbeta, Il-2Rbeta, IL-15Rbeta, Il-2/15Rbeta

Produktbeschreibung

The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 60 kDa
• NCBI: 16185
• UniProt: P16297
• Reinheit: Affinity purification
• Sequenz: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPA
• Target-Kategorie: Il2rb

Anwendungsbeschreibung

• Application Verdünnung: FC,0.25 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Adaptive Immunity T Cells, Immunology Innate Immunity Cytokines Interleukins, Stem Cells Hematopoietic Progenitors Lymphoid NK Cell Lineage. Shipping: Ice Bag

Bilder

Flow cytometry:1X10 6 C57BL/6 mouse splenocytes were surface-stained with APC Rabbit anti-Mouse CD161c/NK1.1 mAb (A25913,5 µl/Test) and PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Mouse CD122/IL-2Rbeta mAb (A28145,0.25 µg,right).