PE Rabbit anti-Mouse CD122/IL-2Rbeta mAb, Monoclonal

Product Overview

• Article Name: PE Rabbit anti-Mouse CD122/IL-2Rbeta mAb, Monoclonal
• Biozol Catalog Number: ABB-A28145
• Supplier Catalog Number: A28145
• Alternative Catalog Number: ABB-A28145-25UG,ABB-A28145-100UG
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: FC
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: PE
• Alternative Names: p70, CD122, IL15Rbeta, Il-2Rbeta, IL-15Rbeta, Il-2/15Rbeta

Product Description

The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.

Product Properties

• Clonality: Monoclonal
• Concentration: FC
• Molecular Weight: 60 kDa
• NCBI: 16185
• UniProt: P16297
• Purity: Affinity purification
• Sequence: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPA
• Target: Il2rb

Application Notes

• Application Dilute: FC,0.25 µg per million cells in 100 µl volume
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Adaptive Immunity T Cells, Immunology Innate Immunity Cytokines Interleukins, Stem Cells Hematopoietic Progenitors Lymphoid NK Cell Lineage. Shipping: Ice Bag

Images

Flow cytometry:1X10 6 C57BL/6 mouse splenocytes were surface-stained with APC Rabbit anti-Mouse CD161c/NK1.1 mAb (A25913,5 µl/Test) and PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Mouse CD122/IL-2Rbeta mAb (A28145,0.25 µg,right).