PE Rabbit anti-Mouse IL-17F mAb, Monoclonal

Artikelnummer: ABB-A28170
Artikelname: PE Rabbit anti-Mouse IL-17F mAb, Monoclonal
Artikelnummer: ABB-A28170
Hersteller Artikelnummer: A28170
Alternativnummer: ABB-A28170-25UG,ABB-A28170-100UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: PE
Alternative Synonym: IL-17F
Enables cytokine receptor binding activity, protein heterodimerization activity, and protein homodimerization activity. Involved in defense response to bacterium and positive regulation of gene expression. Acts upstream of or within positive regulation of cytokine production involved in inflammatory response and positive regulation of transcription by RNA polymerase II. Located in extracellular space. Human ortholog(s) of this gene implicated in chronic mucocutaneous candidiasis. Orthologous to human IL17F (interleukin 17F).
Klonalität: Monoclonal
Konzentration: FC (intra)
Molekulargewicht: 18 kDa
NCBI: 257630
UniProt: Q7TNI7
Reinheit: Affinity purification
Sequenz: MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Target-Kategorie: Il17f
Application Verdünnung: FC (intra),0.25 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Invasion and Metastasis,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Flow cytometry:1X10 6 C57BL/6 mouse splenocytes (untreated,left) and Th17-polarized C57BL/6 mouse splenocytes ( treated with 50ng/ml PMA + 1µg/ml Ionomycin + 1µg/ml Brefeldin A or Monensin for 6 hours ) were surface-stained with APC Rabbit anti-Mouse CD4 mAb (A25934,5 µl/Test) , then intracellularly-stained PE Rabbit anti-Mouse IL-17F mAb (A27862,0.25 µg).