PE Rabbit anti-Mouse IL-17F mAb, Monoclonal

Catalog Number: ABB-A28170
Article Name: PE Rabbit anti-Mouse IL-17F mAb, Monoclonal
Biozol Catalog Number: ABB-A28170
Supplier Catalog Number: A28170
Alternative Catalog Number: ABB-A28170-25UG,ABB-A28170-100UG
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: PE
Alternative Names: IL-17F
Enables cytokine receptor binding activity, protein heterodimerization activity, and protein homodimerization activity. Involved in defense response to bacterium and positive regulation of gene expression. Acts upstream of or within positive regulation of cytokine production involved in inflammatory response and positive regulation of transcription by RNA polymerase II. Located in extracellular space. Human ortholog(s) of this gene implicated in chronic mucocutaneous candidiasis. Orthologous to human IL17F (interleukin 17F).
Clonality: Monoclonal
Concentration: FC (intra)
Molecular Weight: 18 kDa
NCBI: 257630
UniProt: Q7TNI7
Purity: Affinity purification
Sequence: MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Target: Il17f
Application Dilute: FC (intra),0.25 µg per million cells in 100 µl volume
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Invasion and Metastasis,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Flow cytometry:1X10 6 C57BL/6 mouse splenocytes (untreated,left) and Th17-polarized C57BL/6 mouse splenocytes ( treated with 50ng/ml PMA + 1µg/ml Ionomycin + 1µg/ml Brefeldin A or Monensin for 6 hours ) were surface-stained with APC Rabbit anti-Mouse CD4 mAb (A25934,5 µl/Test) , then intracellularly-stained PE Rabbit anti-Mouse IL-17F mAb (A27862,0.25 µg).