PE Rabbit anti-Mouse CD235a/Glycophorin A mAb, Monoclonal

Produktübersicht

• Artikelname: PE Rabbit anti-Mouse CD235a/Glycophorin A mAb, Monoclonal
• Artikelnummer: ABB-A28200
• Hersteller Artikelnummer: A28200
• Alternativnummer: ABB-A28200-25UG,ABB-A28200-100UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: PE
• Alternative Synonym: GPA, CD235a

Produktbeschreibung

Enables identical protein binding activity. Acts upstream of or within regulation of response to osmotic stress. Located in external side of plasma membrane. Is expressed in liver and yolk sac. Human ortholog(s) of this gene implicated in malaria. Orthologous to several human genes including GYPA (glycophorin A (MNS blood group)).

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 18 kDa
• NCBI: 14934
• UniProt: P14220
• Reinheit: Affinity purification
• Sequenz: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV
• Target-Kategorie: Gypa

Anwendungsbeschreibung

• Application Verdünnung: FC,0.5 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs,Cardiovascular,Blood. Shipping: Ice Bag

Bilder

Flow cytometry:1X10 6 C57BL/6 bone marrow cells were surface-stained with ABflo 450 Rabbit anti-Mouse CD45 mAb (A27197,5 µl/Test) and APC anti-Mouse TER-119 mAb (A25661,5 µl/Test) or PE Rabbit anti-Mouse CD235a/Glycophorin A mAb (A28200,0.5µg). Cells in the CD45- gate are used for analysis.