PE Rabbit anti-Mouse CD235a/Glycophorin A mAb, Monoclonal

Product Overview

• Article Name: PE Rabbit anti-Mouse CD235a/Glycophorin A mAb, Monoclonal
• Biozol Catalog Number: ABB-A28200
• Supplier Catalog Number: A28200
• Alternative Catalog Number: ABB-A28200-25UG,ABB-A28200-100UG
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: FC
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: PE
• Alternative Names: GPA, CD235a

Product Description

Enables identical protein binding activity. Acts upstream of or within regulation of response to osmotic stress. Located in external side of plasma membrane. Is expressed in liver and yolk sac. Human ortholog(s) of this gene implicated in malaria. Orthologous to several human genes including GYPA (glycophorin A (MNS blood group)).

Product Properties

• Clonality: Monoclonal
• Concentration: FC
• Molecular Weight: 18 kDa
• NCBI: 14934
• UniProt: P14220
• Purity: Affinity purification
• Sequence: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV
• Target: Gypa

Application Notes

• Application Dilute: FC,0.5 µg per million cells in 100 µl volume
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs,Cardiovascular,Blood. Shipping: Ice Bag

Images

Flow cytometry:1X10 6 C57BL/6 bone marrow cells were surface-stained with ABflo 450 Rabbit anti-Mouse CD45 mAb (A27197,5 µl/Test) and APC anti-Mouse TER-119 mAb (A25661,5 µl/Test) or PE Rabbit anti-Mouse CD235a/Glycophorin A mAb (A28200,0.5µg). Cells in the CD45- gate are used for analysis.