ABflo 610 Rabbit anti-Mouse Ly-6G mAb, Monoclonal

Produktübersicht

• Artikelname: ABflo 610 Rabbit anti-Mouse Ly-6G mAb, Monoclonal
• Artikelnummer: ABB-A28201
• Hersteller Artikelnummer: A28201
• Alternativnummer: ABB-A28201-100UG,ABB-A28201-50UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: ABflo 610
• Alternative Synonym: Gr1, Gr-1, Ly-6G

Produktbeschreibung

Located in external side of plasma membrane.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 28kDa
• NCBI: 546644
• UniProt: P35461
• Reinheit: Affinity purification
• Sequenz: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
• Target-Kategorie: Ly6g

Anwendungsbeschreibung

• Application Verdünnung: FC,0.25 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Neutrophils,Granulocytes,Myeloid Cell Development,Inflammation,Infectious Disease Models,Cancer Immunotherapy. Shipping: Ice Bag

Bilder

Flow cytometry: 1X10 6 C57BL/6 mouse bone marrow cells were surface-stained with ABflo 450 Rabbit anti-Mouse CD11b mAb (A26229,5 µl/Test) and ABflo 610 Rabbit IgG isotype control (5 µl/Test,left) or ABflo 610 Rabbit anti-Mouse Ly-6G mAb (A28201,0.25 µg,right).