ABflo 610 Rabbit anti-Mouse Ly-6G mAb, Monoclonal

Product Overview

• Article Name: ABflo 610 Rabbit anti-Mouse Ly-6G mAb, Monoclonal
• Biozol Catalog Number: ABB-A28201
• Supplier Catalog Number: A28201
• Alternative Catalog Number: ABB-A28201-100UG,ABB-A28201-50UG
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: FC
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: ABflo 610
• Alternative Names: Gr1, Gr-1, Ly-6G

Product Description

Located in external side of plasma membrane.

Product Properties

• Clonality: Monoclonal
• Concentration: FC
• Molecular Weight: 28kDa
• NCBI: 546644
• UniProt: P35461
• Purity: Affinity purification
• Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
• Target: Ly6g

Application Notes

• Application Dilute: FC,0.25 µg per million cells in 100 µl volume
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Neutrophils,Granulocytes,Myeloid Cell Development,Inflammation,Infectious Disease Models,Cancer Immunotherapy. Shipping: Ice Bag

Images

Flow cytometry: 1X10 6 C57BL/6 mouse bone marrow cells were surface-stained with ABflo 450 Rabbit anti-Mouse CD11b mAb (A26229,5 µl/Test) and ABflo 610 Rabbit IgG isotype control (5 µl/Test,left) or ABflo 610 Rabbit anti-Mouse Ly-6G mAb (A28201,0.25 µg,right).