PE Rabbit anti-Mouse T-bet/Tbx21 mAb, Monoclonal

Artikelnummer: ABB-A28217
Artikelname: PE Rabbit anti-Mouse T-bet/Tbx21 mAb, Monoclonal
Artikelnummer: ABB-A28217
Hersteller Artikelnummer: A28217
Alternativnummer: ABB-A28217-25UG,ABB-A28217-100UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: PE
Alternative Synonym: TBT1, Tbet, Tblym
Enables DNA binding activity and DNA-binding transcription activator activity, RNA polymerase II-specific. Involved in several processes, including T-helper 1 cell lineage commitment, negative regulation of T-helper 17 cell lineage commitment, and regulation of gene expression. Acts upstream of or within T cell differentiation and positive regulation of isotype switching to IgG isotypes. Located in neuronal cell body and nucleus. Is expressed in several structures, including central nervous system, colon, genitourinary system, sensory organ, and thymus. Used to study asthma. Human ortholog(s) of this gene implicated in asthma, nasal polyps, and aspirin intolerance and immunodeficiency 88. Orthologous to human TBX21 (T-box transcription factor 21).
Klonalität: Monoclonal
Konzentration: FC (intra)
Molekulargewicht: 58 kDa
NCBI: 57765
UniProt: Q9JKD8
Reinheit: Affinity purification
Sequenz: KGFRENFESMYASVDTSVPSPPGPNCQLLGGDPFSPLLSNQYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFRAVSMKPTLLPSAPGPTVPYYRGQDVLAPGAGWPVAPQYPPKMSPAGWFRPMRTLPMDPGLGSSEEQGSSPSLWPEVTSLQPEPSDSGLGEGDTKRRRISPYPSSGDSSSPAGAPSPFDKETEGQFYNYFPN
Target-Kategorie: Tbx21
Application Verdünnung: FC (intra),0.5 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Adaptive Immunity B Cells Non-CDImmunology Adaptive Immunity T Cells Non-CDEpigenetics and Nuclear Signaling Transcription Domain Families Developmental Families OtherStem Cells Hematopoietic Progenitors Surface Molecules. Shipping: Ice Bag
Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes were surface-stained with ABflo 488 Rat anti-Mouse CD3 mAb (A27161,5 µl/Test) and then intracellularly-stained with PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Mouse T-bet/Tbx21 mAb (A28217,0.5 µg,right).