PE Rabbit anti-Mouse T-bet/Tbx21 mAb, Monoclonal

Catalog Number: ABB-A28217
Article Name: PE Rabbit anti-Mouse T-bet/Tbx21 mAb, Monoclonal
Biozol Catalog Number: ABB-A28217
Supplier Catalog Number: A28217
Alternative Catalog Number: ABB-A28217-25UG,ABB-A28217-100UG
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: PE
Alternative Names: TBT1, Tbet, Tblym
Enables DNA binding activity and DNA-binding transcription activator activity, RNA polymerase II-specific. Involved in several processes, including T-helper 1 cell lineage commitment, negative regulation of T-helper 17 cell lineage commitment, and regulation of gene expression. Acts upstream of or within T cell differentiation and positive regulation of isotype switching to IgG isotypes. Located in neuronal cell body and nucleus. Is expressed in several structures, including central nervous system, colon, genitourinary system, sensory organ, and thymus. Used to study asthma. Human ortholog(s) of this gene implicated in asthma, nasal polyps, and aspirin intolerance and immunodeficiency 88. Orthologous to human TBX21 (T-box transcription factor 21).
Clonality: Monoclonal
Concentration: FC (intra)
Molecular Weight: 58 kDa
NCBI: 57765
UniProt: Q9JKD8
Purity: Affinity purification
Sequence: KGFRENFESMYASVDTSVPSPPGPNCQLLGGDPFSPLLSNQYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFRAVSMKPTLLPSAPGPTVPYYRGQDVLAPGAGWPVAPQYPPKMSPAGWFRPMRTLPMDPGLGSSEEQGSSPSLWPEVTSLQPEPSDSGLGEGDTKRRRISPYPSSGDSSSPAGAPSPFDKETEGQFYNYFPN
Target: Tbx21
Application Dilute: FC (intra),0.5 µg per million cells in 100 µl volume
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Adaptive Immunity B Cells Non-CDImmunology Adaptive Immunity T Cells Non-CDEpigenetics and Nuclear Signaling Transcription Domain Families Developmental Families OtherStem Cells Hematopoietic Progenitors Surface Molecules. Shipping: Ice Bag
Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes were surface-stained with ABflo 488 Rat anti-Mouse CD3 mAb (A27161,5 µl/Test) and then intracellularly-stained with PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Mouse T-bet/Tbx21 mAb (A28217,0.5 µg,right).