ABflo 647 Rabbit anti-Mouse CD119/IFN-gamma receptor 1 mAb, Monoclonal

Produktübersicht

• Artikelname: ABflo 647 Rabbit anti-Mouse CD119/IFN-gamma receptor 1 mAb, Monoclonal
• Artikelnummer: ABB-A28265
• Hersteller Artikelnummer: A28265
• Alternativnummer: ABB-A28265-50UG,ABB-A28265-100UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: ABflo 647
• Alternative Synonym: Ifgr, CD119, Ifngr, Nktar, IFN-gammaR

Produktbeschreibung

Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation, negative regulation of amyloid-beta clearance, and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite, endoplasmic reticulum, and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system, cerebral cortex, cranium, female reproductive system, and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma, hepatitis B, immunodeficiency 27A, immunodeficiency 27B, and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1).

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 52 kDa
• NCBI: 15979
• UniProt: P15261
• Reinheit: Affinity purification
• Sequenz: ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD
• Target-Kategorie: Ifngr1

Anwendungsbeschreibung

• Application Verdünnung: FC,0.5 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology & Inflammation,CD markers,Cytokines,Interferons,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Bilder

Flow cytometry:1X10 6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit anti-Mouse CD161c/NK1.1 mAb (A24107,5 µl/Test) and ABflo 647 Rabbit IgG isotype control (A22070,5 µl/Test,left) or ABflo 647 Rabbit anti-Mouse CD119/IFN-gamma receptor 1 mAb (A28265,0.5 µg,right).