ABflo 647 Rabbit anti-Mouse CD119/IFN-gamma receptor 1 mAb, Monoclonal

Product Overview

• Article Name: ABflo 647 Rabbit anti-Mouse CD119/IFN-gamma receptor 1 mAb, Monoclonal
• Biozol Catalog Number: ABB-A28265
• Supplier Catalog Number: A28265
• Alternative Catalog Number: ABB-A28265-50UG,ABB-A28265-100UG
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: FC
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: ABflo 647
• Alternative Names: Ifgr, CD119, Ifngr, Nktar, IFN-gammaR

Product Description

Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation, negative regulation of amyloid-beta clearance, and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite, endoplasmic reticulum, and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system, cerebral cortex, cranium, female reproductive system, and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma, hepatitis B, immunodeficiency 27A, immunodeficiency 27B, and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1).

Product Properties

• Clonality: Monoclonal
• Concentration: FC
• Molecular Weight: 52 kDa
• NCBI: 15979
• UniProt: P15261
• Purity: Affinity purification
• Sequence: ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD
• Target: Ifngr1

Application Notes

• Application Dilute: FC,0.5 µg per million cells in 100 µl volume
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology & Inflammation,CD markers,Cytokines,Interferons,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Flow cytometry:1X10 6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit anti-Mouse CD161c/NK1.1 mAb (A24107,5 µl/Test) and ABflo 647 Rabbit IgG isotype control (A22070,5 µl/Test,left) or ABflo 647 Rabbit anti-Mouse CD119/IFN-gamma receptor 1 mAb (A28265,0.5 µg,right).