PE Rabbit anti-Mouse CD301b/MGL2 mAb, Monoclonal

Produktübersicht

• Artikelname: PE Rabbit anti-Mouse CD301b/MGL2 mAb, Monoclonal
• Artikelnummer: ABB-A28266
• Hersteller Artikelnummer: A28266
• Alternativnummer: ABB-A28266-25UG,ABB-A28266-100UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: PE
• Alternative Synonym: CD301b

Produktbeschreibung

Enables carbohydrate binding activity. Predicted to be involved in immune response. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including hemolymphoid system gland, ileum, liver, lung, and male reproductive gland or organ. Orthologous to human CLEC10A (C-type lectin domain containing 10A).

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 38 kDa
• NCBI: 216864
• UniProt: Q8JZN1
• Reinheit: Affinity purification
• Sequenz: QNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP
• Target-Kategorie: Mgl2

Anwendungsbeschreibung

• Application Verdünnung: FC,0.5 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Bilder

Flow cytometry: 1X10 6 C57BL/6 Bone Marrow-Derived Dendritic Cells were surface-stained with ABflo 488 Armenian Hamster anti-Mouse CD11c mAb (A26927,5 µl/Test) and PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Mouse CD301b/MGL2 mAb (A28266,0.5 µg,right).